PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02173.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 327aa    MW: 37312.3 Da    PI: 9.1802
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02173.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.7e-1683128147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg W + Ed +l+++v+q+G+ +W+ Ia+++  gR++k+c++rw++ 
  Rsa1.0_02173.1_g00001.1  83 RGHWRPTEDAKLKELVAQFGPQNWNVIAHHLL-GRSGKSCRLRWFNQ 128
                              899****************************9.***********996 PP

2Myb_DNA-binding51.32.8e-16136178246
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                               ++T+eE+ +l+ +++ +G++ W++I+r ++ gRt++ +k++w+ 
  Rsa1.0_02173.1_g00001.1 136 RAFTEEEESRLLAVHRAYGNK-WALISRLFP-GRTDNAVKNHWHV 178
                              689******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.76578129IPR017930Myb domain
SMARTSM007176.0E-1482131IPR001005SANT/Myb domain
SuperFamilySSF466898.24E-2883176IPR009057Homeodomain-like
PfamPF002491.2E-1583128IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-2584136IPR009057Homeodomain-like
CDDcd001671.54E-1286127No hitNo description
PROSITE profilePS5129425.153130184IPR017930Myb domain
SMARTSM007173.2E-14134182IPR001005SANT/Myb domain
PfamPF002491.0E-13136177IPR001005SANT/Myb domain
CDDcd001672.32E-10137177No hitNo description
Gene3DG3DSA:1.10.10.605.6E-20137183IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MNPNLLKKNL TGNYTINDSR RFQERNNFRS PPNSHTDFSL ARNHPHDKSV SGLESGDEHE  60
KERGGNGLKR RGKNGINSKI CSRGHWRPTE DAKLKELVAQ FGPQNWNVIA HHLLGRSGKS  120
CRLRWFNQLD PRINKRAFTE EEESRLLAVH RAYGNKWALI SRLFPGRTDN AVKNHWHVIM  180
SRRTRESQRQ RQVQTPQEPS GNAEMTVISS SCRYNHGDEF FGMVANANVF NKEDDDGDDE  240
DASAVSTCTT ELSLTPPSST HQARFLNYDN TLDPGKDGQC VQRAEVNGKY SKKMDHQNHH  300
TITVSEERKV EMQSGFYFFD FLGVGAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C2e-31801841105C-Myb DNA-Binding Domain
1mse_C2e-31801841105C-Myb DNA-Binding Domain
1gv2_A2e-31831844105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013680888.10.0PREDICTED: myb-related protein B-like
TrEMBLA0A078HJ250.0A0A078HJ25_BRANA; BnaA10g16980D protein
STRINGBra002107.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM99771836
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17800.11e-135myb domain protein 56